frontpage.
newsnewestaskshowjobs

Made with ♥ by @iamnishanth

Open Source @Github

fp.

They Hijacked Our Tech [video]

https://www.youtube.com/watch?v=-nJM5HvnT5k
1•cedel2k1•3m ago•0 comments

Vouch

https://twitter.com/mitchellh/status/2020252149117313349
1•chwtutha•3m ago•0 comments

HRL Labs in Malibu laying off 1/3 of their workforce

https://www.dailynews.com/2026/02/06/hrl-labs-cuts-376-jobs-in-malibu-after-losing-government-work/
2•osnium123•4m ago•1 comments

Show HN: High-performance bidirectional list for React, React Native, and Vue

https://suhaotian.github.io/broad-infinite-list/
1•jeremy_su•5m ago•0 comments

Show HN: I built a Mac screen recorder Recap.Studio

https://recap.studio/
1•fx31xo•8m ago•0 comments

Ask HN: Codex 5.3 broke toolcalls? Opus 4.6 ignores instructions?

1•kachapopopow•13m ago•0 comments

Vectors and HNSW for Dummies

https://anvitra.ai/blog/vectors-and-hnsw/
1•melvinodsa•15m ago•0 comments

Sanskrit AI beats CleanRL SOTA by 125%

https://huggingface.co/ParamTatva/sanskrit-ppo-hopper-v5/blob/main/docs/blog.md
1•prabhatkr•26m ago•1 comments

'Washington Post' CEO resigns after going AWOL during job cuts

https://www.npr.org/2026/02/07/nx-s1-5705413/washington-post-ceo-resigns-will-lewis
2•thread_id•27m ago•1 comments

Claude Opus 4.6 Fast Mode: 2.5× faster, ~6× more expensive

https://twitter.com/claudeai/status/2020207322124132504
1•geeknews•29m ago•0 comments

TSMC to produce 3-nanometer chips in Japan

https://www3.nhk.or.jp/nhkworld/en/news/20260205_B4/
3•cwwc•31m ago•0 comments

Quantization-Aware Distillation

http://ternarysearch.blogspot.com/2026/02/quantization-aware-distillation.html
1•paladin314159•32m ago•0 comments

List of Musical Genres

https://en.wikipedia.org/wiki/List_of_music_genres_and_styles
1•omosubi•33m ago•0 comments

Show HN: Sknet.ai – AI agents debate on a forum, no humans posting

https://sknet.ai/
1•BeinerChes•34m ago•0 comments

University of Waterloo Webring

https://cs.uwatering.com/
1•ark296•34m ago•0 comments

Large tech companies don't need heroes

https://www.seangoedecke.com/heroism/
1•medbar•36m ago•0 comments

Backing up all the little things with a Pi5

https://alexlance.blog/nas.html
1•alance•36m ago•1 comments

Game of Trees (Got)

https://www.gameoftrees.org/
1•akagusu•36m ago•1 comments

Human Systems Research Submolt

https://www.moltbook.com/m/humansystems
1•cl42•37m ago•0 comments

The Threads Algorithm Loves Rage Bait

https://blog.popey.com/2026/02/the-threads-algorithm-loves-rage-bait/
1•MBCook•39m ago•0 comments

Search NYC open data to find building health complaints and other issues

https://www.nycbuildingcheck.com/
1•aej11•43m ago•0 comments

Michael Pollan Says Humanity Is About to Undergo a Revolutionary Change

https://www.nytimes.com/2026/02/07/magazine/michael-pollan-interview.html
2•lxm•44m ago•0 comments

Show HN: Grovia – Long-Range Greenhouse Monitoring System

https://github.com/benb0jangles/Remote-greenhouse-monitor
1•benbojangles•48m ago•1 comments

Ask HN: The Coming Class War

2•fud101•48m ago•4 comments

Mind the GAAP Again

https://blog.dshr.org/2026/02/mind-gaap-again.html
1•gmays•50m ago•0 comments

The Yardbirds, Dazed and Confused (1968)

https://archive.org/details/the-yardbirds_dazed-and-confused_9-march-1968
2•petethomas•51m ago•0 comments

Agent News Chat – AI agents talk to each other about the news

https://www.agentnewschat.com/
2•kiddz•52m ago•0 comments

Do you have a mathematically attractive face?

https://www.doimog.com
3•a_n•56m ago•1 comments

Code only says what it does

https://brooker.co.za/blog/2020/06/23/code.html
2•logicprog•1h ago•0 comments

The success of 'natural language programming'

https://brooker.co.za/blog/2025/12/16/natural-language.html
1•logicprog•1h ago•0 comments
Open in hackernews

New protein therapy shows promise as antidote for carbon monoxide poisoning

https://www.medschool.umaryland.edu/news/2025/new-protein-therapy-shows-promise-as-first-ever-antidote-for-carbon-monoxide-poisoning.html
227•breve•5mo ago

Comments

DonHopkins•5mo ago
>New Protein Therapy Shows Promise as Antidote for Carbon Monoxide Poisoning

So Shatner was right all along: not only is Promise Margarine good for lowering your cholesterol level, but it can also treat carbon monoxide poisoning! And it tastes like butter, promise.

https://www.youtube.com/watch?v=n3wf717fKFE

majkinetor•5mo ago
I don't see a relation of any kind and I hate commercials maybe more than anybody else, but it's always a good time for a funny one with Shatner :)
DonHopkins•5mo ago
Sheez, I can't believe I have to explain that Shatner shows Promise as antidote for high cholesterol too.
selimthegrim•5mo ago
He just played New Orleans. Somebody should’ve been throwing tubs of Promise margarine at the stage.
bananapub•5mo ago
not very on topic, but for those who missed one of the more surreal reddit threads in history:

- [MA] Post-it notes left in apartment [0]

- and the update from OP a while later [1]

[0]: https://www.reddit.com/r/legaladvice/comments/34l7vo/ma_post...

[1]: https://www.reddit.com/r/AskReddit/comments/49zfvb/what_is_t...

gus_massa•5mo ago
It looks like he found a note in his room and see some strange thing in the window, and someone somehow says it's CO but it may be that the OP has unrelated hallucinations. Is this a symptom of CO poisoning? I think you only get sleepy, faint and die.
maxbond•5mo ago
Chronic exposure can lead to memory loss, yes. You're describing the symptoms of acute exposure.
hinkley•5mo ago
CO exposure is accumulative. If you’re around an intense source of it you’re toast. But with a small point source or decent ventilation it kills you slower.

And your body produces new blood cells every day, so minor sources like wood smoke or burning a candle don’t dose you enough to be a problem, unless perhaps your day job is as an athlete.

hinkley•5mo ago
Also looks like the half-life of CO in the blood is around five hours.
phatskat•5mo ago
Reading in a bit more, the second post links to a comment thread where further down they talk about post-it notes.

The original thread about the post its had some updates along the lines of: someone in comments suggested OP get a CO detector. OP says “ya know, I have one. Maybe I should take it out of the box and plug it in.” Later OP said their detector rated the CO at 100ppm! They went to the hospital lol.

Last update I saw was four months after - OP was guessing their recovery would go on for another year, and there was likely some permanent damage but overall they felt confident at getting back to 80%, maybe even 99%.

dtgriscom•5mo ago
How is this administered? Seems like a crucial detail to omit.
DonHopkins•5mo ago
You can spread it on bread, melt it over pancakes, rub it all over corn on the cob, put it in baked potatoes, etc, promise!
elric•5mo ago
> This has the potential to become a rapid, intravenous antidote for carbon monoxide

So intravenously, presumably.

searine•5mo ago
This research was funded by multiple NIH grants, a Department of Defense grant, and the Martin Family Foundation.
jfarlow•5mo ago
Here's the full sequence of the protein, found in the supplement [1]

KSSEPASVSAAERRAETEQHKLEQENPGIVWLDQHGRVTAENDVALQILGPAGEQSLGVAQDSLEGIDVVQLHPEKSRDKLRFLLQSKDVGGSPVKSPPPVAMMINIPDRILMIKVSSMIAAGGASGTSMIFYDVTDLTTEPSGLPAGGSAPSHHHHHH

It is a protein encoding the PxRcoM-1 heme binding domain with C94S mutation and a C-terminal 6xHis tag (RcoM-HBD-C94S)

[1] https://www.pnas.org/doi/10.1073/pnas.2501389122#supplementa...

sunrunner•5mo ago
This looks like an puzzle input to a day from Advent of Code.
meisel•5mo ago
Thanks for that sequence, I can really picture it now
dekhn•5mo ago
You can search for it here: https://alphafold.ebi.ac.uk/search/sequence/KSSEPASVSAAERRAE... and in principle get the AlphaFold predicted structure (I couldn't find an experimentally determined one). However, like nearly all EBI resources, the web server timed out before I could get a link to the prediction.
immibis•5mo ago
Isn't it strange to see protein codes spreading the same way magnet links or AACS encryption keys might.
winocm•5mo ago
If you want to download SARS-CoV-2, here you go: https://www.ncbi.nlm.nih.gov/nuccore/NC_045512.2
mhb•5mo ago
That doesn't look right. I think the problem is in the last quarter. Exercise for the reader.
BurningFrog•5mo ago
How hard is it to manufacture once you know the sequence?
kazinator•5mo ago
The existing methylene blue substance is also effective in cases of CO poisoning.

1933 paper:

https://journals.physiology.org/doi/abs/10.1152/ajplegacy.19...

"Methylene Blue as an Antidote to CO Poisoning", Matilda Moldenhauer Brooks

skadamou•5mo ago
This paper is interesting but I want to point out there is a difference between a research paper showing that something is hypothetically feasible and something that is actually useful clinically.

Clinically, methylene blue is used to treat a different condition, methemeglobinemia and is not used to treat carbon monoxide poisoning which relies on hyperbaric oxygen therapy.

kazinator•5mo ago
The researcher used non-human animals; it worked on them.

The hypothetical part was only that it might also work on humans.

In any case, it seems the result was good enough as a clinical trial from the point of view of veterinary medicine, in regard to those specific types of animals.

amy_petrik•5mo ago
We really shouldn't be taking chemicals used on animals for veteran purposes and use them on humans too. For example, ivermectin. It's a drug meant for horses similar to another horse tranquilizer, ketamine. Can you imagine a human taking ivermectin or ketamine?!? I remember during COVID people were shooting up horse medicine and it was just really bad and upsetting, like these people were crazy. I wish Kamala had won and would have banned this horse medicines like ivermectin.

And now this whole methylene blue thing, RFK takes methylene blue. I mean, guys, this isn't even a horse veteran medicine, it's basically ink used to stain cells. I'm sorry, but everything that has an ink or pigmented color it, there is no way on earth it has a medicinal purpose. I mean. It's ink, nothing more.

kazinator•5mo ago
> We really shouldn't be taking chemicals used on animals for veteran purposes and use them on humans too.

While I totally agree in principle, the specific substance in question (methylene blue) is used on humans already (or should I add was used, at the time of the 1933 study), and for a related emergency purpose: fixing hemoglobin that is poisoned in a certain way, giving rise to a condition called methemoglobinemia.

> And now this whole methylene blue thing, RFK takes methylene blue.

I have no idea about that; I don't follow tabloid stuff.

Methylene blue isn't a now thing; it's been known for a hundred years or more.

> there is no way on earth it has a medicinal purpose

You might be in for a surprise when you do a 15 second web search on it.

RFK playing around with methylene blue doesn't mean anything. If he happens to ascribing to it properties it doesn't have and using it for situations for which it has not been proven, he's engaging in dangerous quackery.

People kill themselves with fentanyl, yet it's an important drug, and on the World Health's Organization list of Essential Medicines: https://list.essentialmeds.org/ (scroll down to the F section).

Oh, look what else is in this list of essential medicines! Methylthioninium chloride. A.k.a. methylene blue.

Yet here you are, claiming that there is no way it has a medicinal purpose?! But you're sure you are smarter than that RFK.

phatskat•5mo ago
> Can you imagine a human taking ivermectin or ketamine?!?

While I can only believe the ivermectin stuff because it happened (and the crossover of people who took it is pretty strong with people likely to think drinking bleach cures autism…), I 100% can believe people take ketamine because I have, and I will again - it’s fun!

Note to the curious: always do your homework. Start at Erowid and learn about any new drug, be sure to get reliably safe drugs, and the golden rule (via Rick and Morty during a Deadmau5 NYE of all places): you can always take more drugs, but you can never take less.

hinkley•5mo ago
> Infused in the bloodstream, scavenger hemoproteins like RcoM-HBD-CCC rapidly bind to carbon monoxide molecules, reducing the time it takes to clear half of the carbon monoxide in the blood to less than a minute, compared to more than hour with pure oxygen therapy and five hours without any treatment.
lawlessone•5mo ago
I can see a market in selling this to urban cyclists..

I've seen people doing that get quite a bit of exhaust fumes to the face.

hinkley•5mo ago
Breath control is an underrated skill.
sandworm101•5mo ago
CO poisioning is one of those strange cases treatable using scuba diving. Recompression therapy, which can be theoretically aped under water, can be like magic. In some cases the patient just wakes up like nothing is wrong. No drugs. No invasive treatment. Get deep enough and hemoglobin isnt totally necessary for getting O2 where it needs to be.

https://www.ncbi.nlm.nih.gov/books/NBK470531/

pfdietz•5mo ago
This looks like a therapy you can only get once in your life, after which it has acted like a vaccine and your immune system would react to it.
isk517•5mo ago
If getting carbon monoxide poisoning once isn't enough to make you invest in a few detectors then I don't know what will
dekhn•5mo ago
Typically, protein therapeutics are "humanized" before being pushed through the drug approval process. Part of that is ensuring that the therapeutic isn't extremely likely to trigger an immune response. It's a nontrivial problem.
pfdietz•5mo ago
Those are usually antibodies, aren't they? This isn't an antibody.

https://en.wikipedia.org/wiki/Humanized_antibody

dekhn•5mo ago
The same rules apply to any protein therapeutic.
pfdietz•5mo ago
The same techniques, however, do not. So how does one humanize an arbitrary protein?
PaulHoule•5mo ago
I guess CO kills you because it sticks to a protein (Hemoglobin), this is a protein that it binds even tighter to.

What I find hilarious though is that my RSS reader loves to show me articles about ways of turning the harmful gas CO2 into the useful gas CO, back when I was a kid it was the other way around!